Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0613000_circ_g.2 |
| ID in PlantcircBase | osa_circ_031371 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 24504315-24504558 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os06g0613000 |
| Parent gene annotation |
Hypothetical conserved gene. (Os06t0613000-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 117 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0613000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.222049522 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24504482-24504523(-) 24504352-24504523(-) |
| Potential amino acid sequence |
MGNQRGKEPGVMIYFLPMGPGRSKSISGMPTSGLPPKNPGGWGNANATFWCCYGTGLTKPVQMD EGR*(-) MQMLHFGAAMGQVSRNLFRWTKEGKYTDHYERLLINGIMGNQRGKEPGVMIYFLPMGPGRSKSI SGMPTSGLPPKNPGGWGNANATFWCCYGTGLTKPVQMDEGR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |