Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc01g005100.2_circ_g.2 |
| ID in PlantcircBase | sly_circ_000005 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr1: 93625-96370 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | Segemehl, CIRI |
| Parent gene | Solyc01g005100.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc01g005100.2_circ_g.1 |
| Support reads | NA |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc01g005100.2.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.111672836 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
93676-95714(-) 94019-96364(-) |
| Potential amino acid sequence |
MLSCTRLMTGIYILLMREAKGESRRVFWLPVRVVCRIHWSDQLV*(-) MTGDVIMYTADDRNIHSVDERG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Tan et al., 2017 |