Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d014674_circ_g.1 |
ID in PlantcircBase | zma_circ_008494 |
Alias | zma_circ_0002125 |
Organism | Zea mays |
Position | chr5: 58603463-58605578 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d014674 |
Parent gene annotation |
UDP-sugar pyrophosphorylase |
Parent gene strand | - |
Alternative splicing | Zm00001d014674_circ_g.2 Zm00001d014674_circ_g.3 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d014674_T001:8 Zm00001d014674_T006:5 Zm00001d014674_T002:6 Zm00001d014674_T005:7 Zm00001d014674_T004:4 Zm00001d014674_T003:8 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.084594317 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
58605548-58605545(-) |
Potential amino acid sequence |
MTSDDTNALTIKLLESNSYFGMEPSQVKLLKQEKVACLADNDARLALDPSDKYKIQTKPHGHGD VHSLLYSSGLLEQWKSEGRKWVLFFQDTNGLLFNAIPSALGVSATKGYNVNSLAVPRKAKEAIG GITKLTHVDGRTMVINVEYNQLDPLLRATGYPDGDTNSETGYSPYPGNINQLILELGPYIEELK KTHGAISEFVNPKYTDSTKTSFKSSTRLECMMQDYPKTLPPSTKVGFTMGAKKRFHLSL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |