Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d014674_circ_g.1 |
| ID in PlantcircBase | zma_circ_008494 |
| Alias | zma_circ_0002125 |
| Organism | Zea mays |
| Position | chr5: 58603463-58605578 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d014674 |
| Parent gene annotation |
UDP-sugar pyrophosphorylase |
| Parent gene strand | - |
| Alternative splicing | Zm00001d014674_circ_g.2 Zm00001d014674_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d014674_T001:8 Zm00001d014674_T006:5 Zm00001d014674_T002:6 Zm00001d014674_T005:7 Zm00001d014674_T004:4 Zm00001d014674_T003:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.084594317 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
58605548-58605545(-) |
| Potential amino acid sequence |
MTSDDTNALTIKLLESNSYFGMEPSQVKLLKQEKVACLADNDARLALDPSDKYKIQTKPHGHGD VHSLLYSSGLLEQWKSEGRKWVLFFQDTNGLLFNAIPSALGVSATKGYNVNSLAVPRKAKEAIG GITKLTHVDGRTMVINVEYNQLDPLLRATGYPDGDTNSETGYSPYPGNINQLILELGPYIEELK KTHGAISEFVNPKYTDSTKTSFKSSTRLECMMQDYPKTLPPSTKVGFTMGAKKRFHLSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |