Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G55750_circ_g.6 |
| ID in PlantcircBase | ath_circ_007600 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 20843303-20844064 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT1G55750 |
| Parent gene annotation |
Probable RNA polymerase II transcription factor B subunit 1-1 |
| Parent gene strand | - |
| Alternative splicing | AT1G55750_circ_g.4 AT1G55750_circ_g.5 AT1G55750_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G55750.4:3 AT1G55750.3:3 AT1G55750.1:3 AT1G55750.5:3 AT1G55750.6:3 AT1G55750.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.251077348 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20844008-20843305(-) |
| Potential amino acid sequence |
MMVSGIKPSTDGRTNRVTFNLTPEIIFQIFAEKPAVRQAFINYVPSKKLLGKDSIRKSKQQLGL KSMMVSGIKPSTDGRTNRVTFNLTPEIIFQIFAEKPAVRQAFINYVPSKKLLGKDSIRKSKQQL GLKSMMVSGIKPSTDGRTNRVTFNLTPEIIFQIFAEKPAVRQAFINYVPSKKLLGKDSIRKSKQ QLGLKSMMVSGIKPSTDGRTNRVTFNLTPEIIFQIFAEKPAVRQAFINYVPSK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |