Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G55750_circ_g.6 |
ID in PlantcircBase | ath_circ_007600 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 20843303-20844064 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G55750 |
Parent gene annotation |
Probable RNA polymerase II transcription factor B subunit 1-1 |
Parent gene strand | - |
Alternative splicing | AT1G55750_circ_g.4 AT1G55750_circ_g.5 AT1G55750_circ_g.7 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G55750.4:3 AT1G55750.3:3 AT1G55750.1:3 AT1G55750.5:3 AT1G55750.6:3 AT1G55750.2:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.251077348 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20844008-20843305(-) |
Potential amino acid sequence |
MMVSGIKPSTDGRTNRVTFNLTPEIIFQIFAEKPAVRQAFINYVPSKKLLGKDSIRKSKQQLGL KSMMVSGIKPSTDGRTNRVTFNLTPEIIFQIFAEKPAVRQAFINYVPSKKLLGKDSIRKSKQQL GLKSMMVSGIKPSTDGRTNRVTFNLTPEIIFQIFAEKPAVRQAFINYVPSKKLLGKDSIRKSKQ QLGLKSMMVSGIKPSTDGRTNRVTFNLTPEIIFQIFAEKPAVRQAFINYVPSK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |