Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G003500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000422 |
| Alias | Chr05:186693|188250 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 186693-188250 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G003500 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.005G003500.2:4 Gorai.005G003500.3:4 Gorai.005G003500.4:4 Gorai.005G003500.1:5 Gorai.005G003500.5:5 Gorai.005G003500.6:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000019* gar_circ_000677 |
| PMCS | 0.104330932 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
188019-188171(+) 187875-188213(-) |
| Potential amino acid sequence |
MLLGYPSFHQVSTYALLVEDVLEVIADRVVVHEAAASRLQRLTKWLVLAMEVRPSLLAGESERI LLQDINKVGDVVLVEDERVMDNDFKMVRLETLVGYRVVTPRYRNIGKVRGYTFNINSGAVESLE IDAFGISIIPSSEHLCFAC*(+) MFRYLGVTTRYPTRVSSLTILKSLSITLSSSTRTTSPTLLISCRRILSDSPASKLGLTSIANTN HFVSLCKREAAAS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |