Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0836400_circ_g.2 |
| ID in PlantcircBase | osa_circ_004756 |
| Alias | Os_ciR6253 |
| Organism | Oryza sativa |
| Position | chr1: 35852124-35853684 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0836400 |
| Parent gene annotation |
Hypothetical conserved gene. (Os01t0836400-01);SAC3/GANP family protein. (Os01t0836400-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0836400-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.116110447 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35852161-35852124(+) 35853580-35852164(+) |
| Potential amino acid sequence |
MVETSQKNYLYKCDQLKSIRQDLTVQRIQNELTVMVYETHARLALQSGDLPEFNQCQSQLKRLY AEGIKGCHFEFSAYNLLCVMLHSNNKRDLLSSMAR*(+) MQKESKAVISNSLLTTCCVSCYTLITKETCFLQWQGKARRCFRESSSYG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |