Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0348600_circ_g.4 |
| ID in PlantcircBase | osa_circ_001663 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 13892467-13892605 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0348600 |
| Parent gene annotation |
Similar to MFP2 (Fatty acid multifunctional protein) (AtMFP2). ( Os01t0348600-01);Similar to glyoxysomal fatty acid beta-oxidatio n multifunctional protein MFP-a. (Os01t0348600-02);Similar to gl yoxysomal fatty acid beta-oxidation multifunctional protein MFP- a. (Os01t0348600-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0348600-03:1 Os01t0348600-02:1 Os01t0348600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.355534532 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13892478-13892514(+) 13892515-13892514(+) 13892517-13892558(-) 13892555-13892558(-) |
| Potential amino acid sequence |
MFWADSIGAKYIHDKLEVWAKRYSDIFKPCSYLAERAANGVPLGRNHVLGRFHWCKVHP*(+) MTSWRCGRSGIATSSSLVPTLQKEQQMGFLWGGIMFWADSIGAKYIHDKLEVWAKRYSDIFKPC SYLAERAANGVPLGRNHVLGRFHWCKVHP*(+) MDVLCTNGICPEHDSSPEEPHLLLFLQGRNKA*(-) MSLYRFAHTSNLSWMYFAPMESAQNMIPPQRNPICCSFCKVGTRLEDVAIPLRPHLQLVMDVLC TNGICPEHDSSPEEPHLLLFLQGRNKA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |