Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d028464_circ_g.1 |
ID in PlantcircBase | zma_circ_006460 |
Alias | Zm01circ00047 |
Organism | Zea mays |
Position | chr1: 35722309-35723648 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d028464 |
Parent gene annotation |
Rho GTPase activation protein (RhoGAP) with PH domain |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d028464_T020:3 Zm00001d028464_T004:3 Zm00001d028464_T007:3 Zm00001d028464_T002:3 Zm00001d028464_T006:3 Zm00001d028464_T017:3 Zm00001d028464_T021:3 Zm00001d028464_T001:3 Zm00001d028464_T016:3 Zm00001d028464_T005:3 Zm00001d028464_T014:3 Zm00001d028464_T008:3 Zm00001d028464_T015:3 Zm00001d028464_T019:3 Zm00001d028464_T010:3 Zm00001d028464_T011:3 Zm00001d028464_T009:3 Zm00001d028464_T013:3 Zm00001d028464_T022:3 Zm00001d028464_T003:3 Zm00001d028464_T018:3 Zm00001d028464_T012:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.060183806 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35722362-35722310(+) 35722902-35722895(+) |
Potential amino acid sequence |
MSAPEFRTSYQQSPENVGQLKVCQCGSGDSNFQITNKSDGGENSPTTCPNCQVLKSGNLLLSSK V*(+) MSVNSRSANVGRATPIFRSQINPTVAKIHQQLVQTVRSLRVEIYCFHLKCDRYHLEVFISQQPR AENVSSGIQDFLPAIP*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |