Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0622700_circ_g.2 |
| ID in PlantcircBase | osa_circ_002741 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 24844745-24845166 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0622700 |
| Parent gene annotation |
Similar to Protein ABIL1. (Os01t0622700-01);Similar to Protein A BIL1. (Os01t0622700-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0622700_circ_g.3 Os01g0622700_circ_g.4 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0622700-02:3 Os01t0622700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.111176935 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24845081-24844902(+) 24845114-24845111(-) 24844935-24845137(-) |
| Potential amino acid sequence |
MFVMSCGGSGHLLLPNAFFIRVSLAGEDLTNSDWRAPLVLEFFSEAKCQKRVFAEG*(+) MTGTATRHHKHYIVPTLANKRMQAFSEMQTDADIDSRPRPYPSAKTLFWHLASEKNSKTNGARQ SEFVKSSPAKLTRIKKALGSSR*(-) MLILTQGLDLIPQQKPFSGIWLQRKTPKPMEHANLNLSSPHLPNLHG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |