Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0793500_circ_g.2 |
| ID in PlantcircBase | osa_circ_022242 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 33002036-33003431 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0793550 |
| Parent gene annotation |
Hypothetical protein. (Os03t0793550-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0793500-01:7 Os03t0793500-02:7 Os03t0793500-01:7 Os03t0793500-02:7 Os03t0793550-00:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.323838771 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33002040-33002036(+) 33002204-33003412(-) |
| Potential amino acid sequence |
MDMLGPSLWDVWNSVGQAMSAHMVACIAVEAISILEKLHSKGFVHGDVKPENFLLGHPGSVDEK KLFLIDLGLASRWKEASSGQHVDYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFL IRGRLPWQGYQGDNKSFLVCKKKMATSPELLCCFCPAPFKHFLEMVTNMKFDEEPNYPKLISLF DGLIEGPASRPIRIDGALKVGQKRGRMVVNLDDDEQPKKKVRLGSPATQWISVYNARRPMKQR* (+) MQATIWADIACPTEFHTSQRLGPSISITSASWAA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |