Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_20G174900_circ_g.4 |
| ID in PlantcircBase | gma_circ_005254 |
| Alias | Gm20circRNA461 |
| Organism | Glycine max |
| Position | chr20: 41242484-41242896 JBrowse» |
| Reference genome | v2.0.38 |
| Type | ue-circRNA |
| Identification method | Tophat, CIRI |
| Parent gene | GLYMA_20G174900 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_20G174900_circ_g.5 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRG91800:2 KRG91797:2 KRG91795:2 KRG91801:2 KRG91798:2 KRG91799:2 KRG91796:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.412933878 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
41242877-41242888(-) 41242500-41242888(-) |
| Potential amino acid sequence |
MRETRSAPAPQKFVAPKFEKKGSAVGRKGLTYLQSFPRGMECVDPLGLGIIDNKTLRLITESSH SSPKTDKDIQDGNLRACS*(-) MATYVLARRVREMRETRSAPAPQKFVAPKFEKKGSAVGRKGLTYLQSFPRGMECVDPLGLGIID NKTLRLITESSHSSPKTDKDIQDGNLRACS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |