Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0175500_circ_g.19 |
| ID in PlantcircBase | osa_circ_029874 |
| Alias | Os_ciR10694 |
| Organism | Oryza sativa |
| Position | chr6: 3805196-3806518 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0175500 |
| Parent gene annotation |
Epsin-like, N-terminal domain containing protein. (Os06t0175500- 01);Similar to predicted protein. (Os06t0175500-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0175500_circ_g.13 Os06g0175500_circ_g.14 Os06g0175500_circ_g.15 Os06g0175500_circ_g.16 Os06g0175500_circ_g.17 Os06g0175500_circ_g.18 Os06g0175500_circ_g.20 Os06g0175500_circ_g.21 Os06g0175500_circ_g.22 Os06g0175500_circ_g.23 Os06g0175500_circ_g.24 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0175500-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.346386905 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3806487-3806498(-) |
| Potential amino acid sequence |
MAGVGTQPTSLRKYLGALKDTTTVSLAKVNSDYKELDIAIVKATNHVERPSKEKYIREIFYSIS ASRPRADVAYCIHALARRLSKTRNWAVALKTLIVIHRALREVDPTFREELINYGRSRSHMLNLA YFKDDSSAGGQVVYHL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |