Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0123100_circ_g.3 |
ID in PlantcircBase | osa_circ_038452 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 1782578-1783158 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0123100 |
Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os09t 0123100-01) |
Parent gene strand | + |
Alternative splicing | Os09g0123100_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0123100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018514 zma_circ_001144 |
PMCS | 0.181845181 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1783143-1782683(+) 1783105-1782585(+) 1782677-1783100(-) 1782607-1783126(-) |
Potential amino acid sequence |
MHRMPREEVKSLPVHLDNKLILPMGQETVFLLDQEGVALYL*(+) MLSVVGYYISFARCIECREKK*(+) MPLPLDPEETLFPVPLAESVCCLDAQASSSLLLAAFDASCKANVISNNRKHT*(-) MHRQALHFFSRHSMHLAKLM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |