Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0123100_circ_g.3 |
| ID in PlantcircBase | osa_circ_038452 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 1782578-1783158 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0123100 |
| Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os09t 0123100-01) |
| Parent gene strand | + |
| Alternative splicing | Os09g0123100_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0123100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018514 zma_circ_001144 |
| PMCS | 0.181845181 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1783143-1782683(+) 1783105-1782585(+) 1782677-1783100(-) 1782607-1783126(-) |
| Potential amino acid sequence |
MHRMPREEVKSLPVHLDNKLILPMGQETVFLLDQEGVALYL*(+) MLSVVGYYISFARCIECREKK*(+) MPLPLDPEETLFPVPLAESVCCLDAQASSSLLLAAFDASCKANVISNNRKHT*(-) MHRQALHFFSRHSMHLAKLM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |