Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0573600_circ_g.6 |
| ID in PlantcircBase | osa_circ_031238 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 22248733-22249067 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os06g0573600 |
| Parent gene annotation |
Similar to Beta-galactosidase precursor (EC 3.2.1.23) (Lactase). (Os06t0573600-01);Similar to Beta-galactosidase. (Os06t0573600- 02);Similar to Beta-galactosidase. (Os06t0573600-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 16 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0573600-01:1 Os06t0573600-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016358 |
| PMCS | 0.311714726 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22249030-22249024(-) 22248738-22249067(-) |
| Potential amino acid sequence |
MLSCSTRPSLVKAVSSSELVASPYDCQVNPPAGFIFAGDDAAVTVAVLYTAVLQSGSTLMDHAG RSYRRPLNATLAAALVWKLDRNAAQSPLLDLNTYARWCTTGSRTCPTSC*(-) MLGGVPQVVGLVPRHAELLDEAVLGEGRLVQRVGGLAVRLPGEPARRVHLRRRRRRRHRRGVVH GGPAVRQHADGPRREVVPPPVERHPRRRARVEVGQERRAVAAARPEHVC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |