Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0573600_circ_g.6 |
ID in PlantcircBase | osa_circ_031238 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 22248733-22249067 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os06g0573600 |
Parent gene annotation |
Similar to Beta-galactosidase precursor (EC 3.2.1.23) (Lactase). (Os06t0573600-01);Similar to Beta-galactosidase. (Os06t0573600- 02);Similar to Beta-galactosidase. (Os06t0573600-03) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 16 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0573600-01:1 Os06t0573600-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016358 |
PMCS | 0.311714726 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22249030-22249024(-) 22248738-22249067(-) |
Potential amino acid sequence |
MLSCSTRPSLVKAVSSSELVASPYDCQVNPPAGFIFAGDDAAVTVAVLYTAVLQSGSTLMDHAG RSYRRPLNATLAAALVWKLDRNAAQSPLLDLNTYARWCTTGSRTCPTSC*(-) MLGGVPQVVGLVPRHAELLDEAVLGEGRLVQRVGGLAVRLPGEPARRVHLRRRRRRRHRRGVVH GGPAVRQHADGPRREVVPPPVERHPRRRARVEVGQERRAVAAARPEHVC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |