Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G48190_circ_g.16 |
| ID in PlantcircBase | ath_circ_026529 |
| Alias | At_ciR5236, Ath_circ_FC5304 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 17828032-17828175 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT3G48190 |
| Parent gene annotation |
Serine/Threonine-kinase ATM-like protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G48190.2:1 AT3G48190.3:1 AT3G48190.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.200866668 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17828053-17828172(+) |
| Potential amino acid sequence |
MNLEGLQEEFEGNKDATRALMRVKQKLDGYEGGEMRSIHGQETEDYDGMNLEGLQEEFEGNKDA TRALMRVKQKLDGYEGGEMRSIHGQETEDYDGMNLEGLQEEFEGNKDATRALMRVKQKLDGYEG GEMRSIHGQETEDYDGMNLEGLQEEFEGNKDATRALMRVKQKLDGYEGGEMRSIHGQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chen et al., 2017a |