Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0705600_circ_g.2 |
| ID in PlantcircBase | osa_circ_016163 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 29138411-29138518 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0705600 |
| Parent gene annotation |
Armadillo-like helical domain containing protein. (Os02t0705600- 01);Armadillo-like helical domain containing protein. (Os02t0705 600-02);Armadillo-like helical domain containing protein. (Os02t 0705600-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0705600-02:1 Os02t0705600-03:1 Os02t0705600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.193675309 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29138437-29138411(+) 29138439-29138413(-) |
| Potential amino acid sequence |
MFSIRNKLRLSESLILSHRDTIASPVIA*(+) MVPPALANQAITGEAIVSRCERIRDSLRRSLFLIENMVPPALANQAITGEAIVSRCERIRDSLR RSLFLIENMVPPALANQAITGEAIVSRCERIRDSLRRSLFLIENMVPPALANQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |