Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0246200_circ_g.4 |
| ID in PlantcircBase | osa_circ_033285 |
| Alias | Os_ciR1268 |
| Organism | Oryza sativa |
| Position | chr7: 8138995-8139324 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os07g0246200 |
| Parent gene annotation |
Similar to Calreticulin (Fragment). (Os07t0246200-01);Similar to Calreticulin (Fragment). (Os07t0246200-02);Similar to calreticu lin2. (Os07t0246200-03) |
| Parent gene strand | + |
| Alternative splicing | Os07g0246200_circ_g.1 Os07g0246200_circ_g.2 Os07g0246200_circ_g.3 Os07g0246200_circ_g.5 Os07g0246200_circ_g.6 Os07g0246200_circ_g.7 Os07g0246200_circ_g.8 Os07g0246200_circ_g.9 Os07g0246200_circ_g.10 Os07g0246200_circ_g.11 Os07g0246200_circ_g.12 Os07g0246200_circ_g.13 Os07g0246200_circ_g.14 Os07g0246200_circ_g.15 Os07g0246200_circ_g.16 Os07g0246200_circ_g.17 Os07g0246200_circ_g.18 Os07g0246200_circ_g.19 Os07g0246200_circ_g.20 Os07g0246200_circ_g.21 Os07g0246200_circ_g.22 Os07g0246200_circ_g.23 |
| Support reads | 12/6 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0246200-03:2 Os07t0246200-01:2 Os07t0246200-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.408990985 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8139009-8139321(+) 8139025-8138997(-) |
| Potential amino acid sequence |
MTRSTFLTLRTRSLRDTMIFPRKSLTLMLRSQRTGMTRSTFLTLRTRSLRDTMIFPRKSLTLML RSQRTGMTRSTFLTLRTRSLRDTMIFPRKSLTLMLRSQRTGMTRSTFLTLRTRSLRDTMIFPRK SLTLMLR(+) MYSLSSQSSGFLASGSGISLGISSYPSGFLSSGSGMYSLSSQSSGFLASGSGISLGISSYPSGF LSSGSGMYSLSSQSSGFLASGSGISLGISSYPSGFLSSGSGMYSLSSQSS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |