Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0246200_circ_g.4 |
ID in PlantcircBase | osa_circ_033285 |
Alias | Os_ciR1268 |
Organism | Oryza sativa |
Position | chr7: 8138995-8139324 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os07g0246200 |
Parent gene annotation |
Similar to Calreticulin (Fragment). (Os07t0246200-01);Similar to Calreticulin (Fragment). (Os07t0246200-02);Similar to calreticu lin2. (Os07t0246200-03) |
Parent gene strand | + |
Alternative splicing | Os07g0246200_circ_g.1 Os07g0246200_circ_g.2 Os07g0246200_circ_g.3 Os07g0246200_circ_g.5 Os07g0246200_circ_g.6 Os07g0246200_circ_g.7 Os07g0246200_circ_g.8 Os07g0246200_circ_g.9 Os07g0246200_circ_g.10 Os07g0246200_circ_g.11 Os07g0246200_circ_g.12 Os07g0246200_circ_g.13 Os07g0246200_circ_g.14 Os07g0246200_circ_g.15 Os07g0246200_circ_g.16 Os07g0246200_circ_g.17 Os07g0246200_circ_g.18 Os07g0246200_circ_g.19 Os07g0246200_circ_g.20 Os07g0246200_circ_g.21 Os07g0246200_circ_g.22 Os07g0246200_circ_g.23 |
Support reads | 12/6 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0246200-03:2 Os07t0246200-01:2 Os07t0246200-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.408990985 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8139009-8139321(+) 8139025-8138997(-) |
Potential amino acid sequence |
MTRSTFLTLRTRSLRDTMIFPRKSLTLMLRSQRTGMTRSTFLTLRTRSLRDTMIFPRKSLTLML RSQRTGMTRSTFLTLRTRSLRDTMIFPRKSLTLMLRSQRTGMTRSTFLTLRTRSLRDTMIFPRK SLTLMLR(+) MYSLSSQSSGFLASGSGISLGISSYPSGFLSSGSGMYSLSSQSSGFLASGSGISLGISSYPSGF LSSGSGMYSLSSQSSGFLASGSGISLGISSYPSGFLSSGSGMYSLSSQSS(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |