Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d015400_circ_g.2 |
| ID in PlantcircBase | zma_circ_008612 |
| Alias | zma_circ_0002245, GRMZM2G082683_C1 |
| Organism | Zea mays |
| Position | chr5: 88445424-88446948 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d015400 |
| Parent gene annotation |
S-adenosyl-L-methionine-dependent methyltransferases superfamily protein |
| Parent gene strand | + |
| Alternative splicing | Zm00001d015400_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d015400_T005:2 Zm00001d015400_T001:1 Zm00001d015400_T003:1 Zm00001d015400_T002:3 Zm00001d015400_T004:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.091036803 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
88446394-88445453(+) 88446408-88446900(-) |
| Potential amino acid sequence |
MENGIVYLVSLEGQKTGFYADQRENRYIISLLSKDQRVLDLCCYSGGFALNAAKGGADNVIGID SSGSALDLANENIVLNELNQGKVSFVKGDATTFMKGAISENELWDLVILDPPKLAPRKKIVWSN SGHLC*(+) MPFSMTLTVEHVEAGSLCSDISNPSSFKISVDGLHFIWLTPLTLLTRNCISCLYFSTQAADEAM TATSAKMSTIRPDNLLSWRQLWRVKDYQVP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |