Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G27410_circ_g.1 |
| ID in PlantcircBase | ath_circ_040758 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 9679240-9679670 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT5G27410 |
| Parent gene annotation |
D-aminoacid aminotransferase-like PLP-dependent enzymes superfam ily protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1/5 |
| Tissues | aerial/seedlings |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G27410.2:3 AT5G27410.3:3 AT5G27410.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.230073465 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9679336-9679667(+) |
| Potential amino acid sequence |
MECDGEKVVKDIIYGPGKKKYRFCKHISKQRLLGLPSELMSEGKHFILIRNPLNILRDDIEVLD EPLYAAFLKSTGVDRPYKDELLSKMECDGEKVVKDIIYGPGKKKYRFCKHISKQRLLGLPSELM SEGKHFILIRNPLNILRDDIEVLDEPLYAAFLKSTGVDRPYKDELLSKMECDGEKVVKDIIYGP GKKKYRFCKHISKQRLLGLPSELMSEGKHFILIRNPLNILRDDIEVLDEPLYAAFLKSTGVDRP YKDELLSKMECDGEKVVKDIIYGPGKKKYRFCKHISKQRLLGLPSELMSEGKHFILIRNPLNIL (+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to heat stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Pan et al., 2017 |