Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G46210_circ_g.1 |
| ID in PlantcircBase | ath_circ_026233 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 16977211-16977490 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder |
| Parent gene | AT3G46210 |
| Parent gene annotation |
Exosome complex exonuclease RRP46 homolog |
| Parent gene strand | - |
| Alternative splicing | AT3G46210_circ_g.2 AT3G46210_circ_g.3 AT3G46210_circ_g.4 AT3G46210_circ_g.5 AT3G46210_circ_g.6 AT3G46210_circ_g.7 |
| Support reads | 2 |
| Tissues | root, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G46210.1:2 AT3G46210.6:2 AT3G46210.5:2 AT3G46210.7:2 AT3G46210.4:2 AT3G46210.2:2 AT3G46210.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.353437004 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16977341-16977213(-) |
| Potential amino acid sequence |
MTAFAYLVFPNTTLSVLPEGSSVAEGEPVEHGIITSITHGVMSVAICCCLAENGYLVLDPNKLE EKKMTAFAYLVFPNTTLSVLPEGSSVAEGEPVEHGIITSITHGVMSVAICCCLAENGYLVLDPN KLEEKKMTAFAYLVFPNTTLSVLPEGSSVAEGEPVEHGIITSITHGVMSVAICCCLAENGYLVL DPNKLEEKKMTAFAYLVFPNTTLSVLPEGSSVAEGEPVEHGIITSITHGVMS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |