Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0542800_circ_g.1 |
| ID in PlantcircBase | osa_circ_028727 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 26940962-26941132 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0542800 |
| Parent gene annotation |
Pectin lyase fold/virulence factor domain containing protein. (O s05t0542800-01);Similar to polygalacturonase. (Os05t0542800-02); Similar to polygalacturonase. (Os05t0542800-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0542800-02:1 Os05t0542800-03:1 Os05t0542800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.29889961 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26941086-26941129(+) |
| Potential amino acid sequence |
MGAEWWARSCKRKKTKISGTIAAPASPDEWAGRDPTKWLYVFRVDDLSVSGGGTIDGMGAEWWA RSCKRKKTKISGTIAAPASPDEWAGRDPTKWLYVFRVDDLSVSGGGTIDGMGAEWWARSCKRKK TKISGTIAAPASPDEWAGRDPTKWLYVFRVDDLSVSGGGTIDGMGAEWWARSCKRKKTK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |