Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G02148_circ_g.1 |
ID in PlantcircBase | ath_circ_012540 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 547577-547801 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full |
Parent gene | AT2G02148 |
Parent gene annotation |
Uncharacterized protein At2g02148 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 8 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G02148.2:1 AT2G02148.3:1 AT2G02148.5:1 AT2G02148.1:1 AT2G02148.4:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.187774593 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
547757-547579(-) |
Potential amino acid sequence |
MSSLSHQFHQSIHQSHQHHQSIYQSQHAATHYPSQNHQCDPELSHTQMACLQPLTGGHVMDQSQ QQHTPSPSKHHMSSLSHQFHQSIHQSHQHHQSIYQSQHAATHYPSQNHQCDPELSHTQMACLQP LTGGHVMDQSQQQHTPSPSKHHMSSLSHQFHQSIHQSHQHHQSIYQSQHAATHYPSQNHQCDPE LSHTQMACLQPLTGGHVMDQSQQQHTPSPSKHHMSSLSHQFHQSIHQSHQHHQSIYQSQHAATH YPSQNHQCDPELSHTQMACLQPLTGGHVM(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |