Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G02148_circ_g.1 |
| ID in PlantcircBase | ath_circ_012540 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 547577-547801 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full |
| Parent gene | AT2G02148 |
| Parent gene annotation |
Uncharacterized protein At2g02148 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 8 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G02148.2:1 AT2G02148.3:1 AT2G02148.5:1 AT2G02148.1:1 AT2G02148.4:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.187774593 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
547757-547579(-) |
| Potential amino acid sequence |
MSSLSHQFHQSIHQSHQHHQSIYQSQHAATHYPSQNHQCDPELSHTQMACLQPLTGGHVMDQSQ QQHTPSPSKHHMSSLSHQFHQSIHQSHQHHQSIYQSQHAATHYPSQNHQCDPELSHTQMACLQP LTGGHVMDQSQQQHTPSPSKHHMSSLSHQFHQSIHQSHQHHQSIYQSQHAATHYPSQNHQCDPE LSHTQMACLQPLTGGHVMDQSQQQHTPSPSKHHMSSLSHQFHQSIHQSHQHHQSIYQSQHAATH YPSQNHQCDPELSHTQMACLQPLTGGHVM(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |