Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0101800_circ_g.2 |
ID in PlantcircBase | osa_circ_000024 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 85737-86086 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os01g0101800 |
Parent gene annotation |
Conserved hypothetical protein. (Os01t0101800-01) |
Parent gene strand | + |
Alternative splicing | Os01g0101800_circ_g.1 Os01g0101800_circ_g.3 |
Support reads | 1 |
Tissues | shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0101800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.556863078 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
86085-86083(+) 85975-85812(+) |
Potential amino acid sequence |
MVVQRSKLVHAPASFGYRRLLPFLNQLTNTNQESECPSGKDNSKIDAYAESESEAQPDPVHCSI STTKEEINISSSHLSSTKMVVQRSKLVHAPASFGYRRLLPFLNQLTNTNQESECPSGKDNSKID AYAESESEAQPDPVHCSISTTKEEINISSSHLSSTKMVVQRSKLVHAPASFGYRRLLPFLNQLT NTNQESECPSGKDNSKIDAYAESESEAQPDPVHCSISTTKEEINISSSHLSSTKM(+) MHMPNLNLKLNLILCIALSAPPRKKSTFPLLIFQAPRWSSSGRSSCTPRPPSATAAYCLSSTN* (+) |
Sponge-miRNAs | osa-miR2919 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |