Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0101800_circ_g.2 |
| ID in PlantcircBase | osa_circ_000024 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 85737-86086 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os01g0101800 |
| Parent gene annotation |
Conserved hypothetical protein. (Os01t0101800-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0101800_circ_g.1 Os01g0101800_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0101800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.556863078 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
86085-86083(+) 85975-85812(+) |
| Potential amino acid sequence |
MVVQRSKLVHAPASFGYRRLLPFLNQLTNTNQESECPSGKDNSKIDAYAESESEAQPDPVHCSI STTKEEINISSSHLSSTKMVVQRSKLVHAPASFGYRRLLPFLNQLTNTNQESECPSGKDNSKID AYAESESEAQPDPVHCSISTTKEEINISSSHLSSTKMVVQRSKLVHAPASFGYRRLLPFLNQLT NTNQESECPSGKDNSKIDAYAESESEAQPDPVHCSISTTKEEINISSSHLSSTKM(+) MHMPNLNLKLNLILCIALSAPPRKKSTFPLLIFQAPRWSSSGRSSCTPRPPSATAAYCLSSTN* (+) |
| Sponge-miRNAs | osa-miR2919 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |