Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G55070_circ_g.2 |
| ID in PlantcircBase | ath_circ_044188 |
| Alias | AT5G55070_C1, AT5G55070_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 22347625-22348310 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT5G55070 |
| Parent gene annotation |
Dihydrolipoyllysine-residue succinyltransferase component of 2-o xoglutarate dehydrogenase complex 1, mitochondrial |
| Parent gene strand | + |
| Alternative splicing | AT5G55070_circ_g.1 AT5G55070_circ_g.3 AT5G55070_circ_g.4 AT5G55070_circ_g.5 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G55070.2:5 AT5G55070.1:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.187605408 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22347638-22347656(+) 22348025-22347656(+) |
| Potential amino acid sequence |
MMLRAVFRRASIRGSSSASGLGKSLQSSRVAVSAQFHSVSATETLVPRGNHAHSFHHRSCPGCP DCSRTIINGYQGTALQRWVRPFSSDSEIWCDDVACCF* MLIASITVLVQGVQTVQGLLSTVTKAQPCKDGSGPFHLIVRFGAMMLRAVFRRASIRGSSSASG LGKSLQSSRVAVSAQFHSVSATETLVPRGNHAHSFHHRSCPGCPDCSRTIINGYQGTALQRWVR PFSSDSEIWCDDVACCF* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |