Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0102800_circ_g.1 |
ID in PlantcircBase | osa_circ_012624 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 148181-148992 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0102800 |
Parent gene annotation |
Pleckstrin homology-type domain containing protein. (Os02t010280 0-01);Similar to START domain-containing protein. (Os02t0102800- 02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3 |
Tissues | anther |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0102800-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.123768196 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
148182-148203(+) 148991-148203(+) |
Potential amino acid sequence |
MVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNIELIIDQQENMTSKNRKAFASMDFDTELGGQ FIFSDHDSAAEDEEERPMLIRRTTIGNDGLCPVRL*(+) MMVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNIELIIDQQENMTSKNRKAFASMDFDTELGG QFIFSDHDSAAEDEEERPMLIRRTTIGNDGLCPVRL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |