Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0102800_circ_g.1 |
| ID in PlantcircBase | osa_circ_012624 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 148181-148992 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0102800 |
| Parent gene annotation |
Pleckstrin homology-type domain containing protein. (Os02t010280 0-01);Similar to START domain-containing protein. (Os02t0102800- 02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | anther |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0102800-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.123768196 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
148182-148203(+) 148991-148203(+) |
| Potential amino acid sequence |
MVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNIELIIDQQENMTSKNRKAFASMDFDTELGGQ FIFSDHDSAAEDEEERPMLIRRTTIGNDGLCPVRL*(+) MMVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNIELIIDQQENMTSKNRKAFASMDFDTELGG QFIFSDHDSAAEDEEERPMLIRRTTIGNDGLCPVRL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |