Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0978000_circ_g.1 |
| ID in PlantcircBase | osa_circ_006076 |
| Alias | Os_ciR1715 |
| Organism | Oryza sativa |
| Position | chr1: 43226614-43227033 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0978000 |
| Parent gene annotation |
Similar to Uncoupling protein. (Os01t0978000-01);Similar to Unco upling protein. (Os01t0978000-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 11/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0978000-02:2 Os01t0978000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011268 |
| PMCS | 0.398512718 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
43226711-43226825(+) |
| Potential amino acid sequence |
MLGTIMCIAREEGVAALWNGIIPGLHRQCVYGGLRIALYEPVKAFFIRDGDTVAGGVSLFAKIL AALMTGVHHSSRHSQSAASAAKESSPSYRRRRRDHWRNAGHNNVHRKGGRGGRALERHHPWPSP PVRLWRTPHRLV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |