Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0978000_circ_g.1 |
ID in PlantcircBase | osa_circ_006076 |
Alias | Os_ciR1715 |
Organism | Oryza sativa |
Position | chr1: 43226614-43227033 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0978000 |
Parent gene annotation |
Similar to Uncoupling protein. (Os01t0978000-01);Similar to Unco upling protein. (Os01t0978000-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 11/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0978000-02:2 Os01t0978000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011268 |
PMCS | 0.398512718 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
43226711-43226825(+) |
Potential amino acid sequence |
MLGTIMCIAREEGVAALWNGIIPGLHRQCVYGGLRIALYEPVKAFFIRDGDTVAGGVSLFAKIL AALMTGVHHSSRHSQSAASAAKESSPSYRRRRRDHWRNAGHNNVHRKGGRGGRALERHHPWPSP PVRLWRTPHRLV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |