Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa3G642670_circ_g.1 |
| ID in PlantcircBase | csa_circ_001856 |
| Alias | Chr3:25129127_25129468 |
| Organism | Cucumis sativus |
| Position | chrChr3: 25129127-25129468 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | Csa3G642670 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | Csa3G642670_circ_g.2 Csa3G642670_circ_g.3 Csa3G642670_circ_g.4 Csa3G642670_circ_g.5 Csa3G642670_circ_g.6 Chr3_circ_ig.91 Chr3_circ_ig.92 Chr3_circ_ig.93 Chr3_circ_ig.94 |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Csa3G642670.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.054336623 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25129344-25129186(+) 25129442-25129161(+) |
| Potential amino acid sequence |
MFKFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWTHFRGTSKEEKGNSTFQSGFNEICVWFE* MDSLSGYLQGGEREFDISIRV* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhu et al., 2019 |