Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0268200_circ_g.1 |
| ID in PlantcircBase | osa_circ_019064 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 8898019-8898374 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0268250 |
| Parent gene annotation |
Hypothetical protein. (Os03t0268250-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0268200-01:1 Os03t0268200-03:1 Os03t0268200-04:1 Os03t0268200-02:1 Os03t0268200-01:1 Os03t0268200-03:1 Os03t0268200-04:1 Os03t0268250-00:1 Os03t0268200-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.273001147 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8898341-8898145(+) 8898288-8898357(-) 8898209-8898335(-) |
| Potential amino acid sequence |
MESHLLCPMVSGFWITTFRVVPFITLVFLDSPRMVQALTTRCVIISPNIFRDQT*(+) MPFPLDDESTGQDEGPVSDSKSAIKSYGFATSKRLDKTSGQSPTKHSSLVSKYIRGNNYASSSQ RLDHPRRIKENKGDEGHNPKGGYPEAGHHRT*(-) MGLPRVKGLIKLQVRVQRNIQVWSLNILGEIITHLVVNAWTILGESRKTRVMKGTTLKVVIQKP DTIGHKRWLSIH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |