Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA024431_circ_g.4 |
ID in PlantcircBase | osi_circ_007135 |
Alias | 7:11959781|11962216 |
Organism | Oryza sativa ssp. indica |
Position | chr7: 11959781-11962216 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA024431 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA024431_circ_g.1 BGIOSGA024431_circ_g.2 BGIOSGA024431_circ_g.3 BGIOSGA024431_circ_g.5 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA024431-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_033483* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11960026-11962177(-) |
Potential amino acid sequence |
MRQFVKYSRFKQFALRALASTLNAEELSDLRDQFNAIDVDKNGTISLEELKQGNTFVTLLEVPT M*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |