Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0810600_circ_g.3 |
| ID in PlantcircBase | osa_circ_022390 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 33932970-33933340 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0810600 |
| Parent gene annotation |
Miro-like domain containing protein. (Os03t0810600-01);Similar t o ATP/GTP/Ca++ binding protein. (Os03t0810600-02);Similar to pre dicted protein. (Os03t0810600-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0810600-01:2 Os03t0810600-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013802 |
| PMCS | 0.271122394 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33932999-33933113(+) 33933043-33933268(-) |
| Potential amino acid sequence |
MQVSISLNVCMMGAITCSRLTCCSSLRSSLHPTTITGAFNWRRRSSGSQNVLSRSSVAGLSQAY VSTTASAAWHSAISFALCSGLDLAKRRALNAGLDLSECLHDGRHHLLKADLLLVPKVQLTPHDN HRCL*(+) MAPIMQTFREIETCIECSALRQIQPGAQGEADRRVPGGGRGGAHVRLR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |