Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G22000_circ_g.4 |
| ID in PlantcircBase | ath_circ_039705 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 7278250-7278312 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT5G22000 |
| Parent gene annotation |
RHF2A |
| Parent gene strand | + |
| Alternative splicing | AT5G22000_circ_g.1 AT5G22000_circ_g.2 AT5G22000_circ_g.3 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G22000.3:1 AT5G22000.4:1 AT5G22000.2:1 AT5G22000.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.255293517 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7278275-7278309(+) |
| Potential amino acid sequence |
MCWQSISLKDPTRCQRSSQCPMCWQSISLKDPTRCQRSSQCPMCWQSISLKDPTRCQRSSQCPM CWQSISLKDPT(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |