Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d037346_circ_g.4 |
ID in PlantcircBase | zma_circ_009024 |
Alias | Zm06circ00049 |
Organism | Zea mays |
Position | chr6: 122242564-122245094 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d037346 |
Parent gene annotation |
Chromatin structure-remodeling complex protein SYD |
Parent gene strand | + |
Alternative splicing | Zm00001d037346_circ_g.5 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d037346_T010:5 Zm00001d037346_T002:3 Zm00001d037346_T007:5 Zm00001d037346_T006:5 Zm00001d037346_T017:5 Zm00001d037346_T001:3 Zm00001d037346_T011:5 Zm00001d037346_T005:5 Zm00001d037346_T009:5 Zm00001d037346_T012:5 Zm00001d037346_T008:5 Zm00001d037346_T016:5 Zm00001d037346_T003:5 Zm00001d037346_T013:5 Zm00001d037346_T004:5 Zm00001d037346_T014:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.127221197 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
122242897-122242618(+) 122244807-122242571(+) 122242615-122244919(-) |
Potential amino acid sequence |
MKEERQKRIRERQKEFFADIEAYREKLEDNFKDAKSDRVKQLLRETEKYLQKLGNKLQSAKSTD GRSSFVTDKSDTANDIEDESYQPQHYLESNEKYYQLAHRRALIHPKIFLQRPRASLN*(+) MQNLIVSSNYCVKLRNIFRNLGTNYRVQSPQMAAHLLLLIRVTLQTTLKMRATSHSIIWKVMKS TINWHTGER*(+) MTLLVFAERSSDELTLSCVPVDSTFHYFPDNAVAGSSHLQCRLQCHSYQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |