Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0407950_circ_g.9 |
| ID in PlantcircBase | osa_circ_039140 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 14411216-14411935 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0407950 |
| Parent gene annotation |
Similar to transducin family protein / WD-40 repeat family prote in. (Os09t0407950-01) |
| Parent gene strand | + |
| Alternative splicing | Os09g0407950_circ_g.7 Os09g0407950_circ_g.8 Os09g0407950_circ_g.10 Os09g0407950_circ_g.11 Os09g0407950_circ_g.12 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0407950-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.29530669 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14411277-14411234(+) 14411478-14411933(-) |
| Potential amino acid sequence |
MIASADLDILSSSSTKYDRGLPSYRSMLWVGPALIFSSATAISMLGWDNKVRSILSTSFPRSVL LGALNDRLLLVNPTDINPRQKKGVEIRSCLIGLLEPLLIGFATMQQYFEQKLDLSEVLYQITSR FTGKQL*(+) MMEDPGHILLSCLKVCQDQQRLSLPSGLSIFLQQDLLELFASEP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |