Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0407950_circ_g.9 |
ID in PlantcircBase | osa_circ_039140 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 14411216-14411935 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0407950 |
Parent gene annotation |
Similar to transducin family protein / WD-40 repeat family prote in. (Os09t0407950-01) |
Parent gene strand | + |
Alternative splicing | Os09g0407950_circ_g.7 Os09g0407950_circ_g.8 Os09g0407950_circ_g.10 Os09g0407950_circ_g.11 Os09g0407950_circ_g.12 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0407950-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.29530669 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14411277-14411234(+) 14411478-14411933(-) |
Potential amino acid sequence |
MIASADLDILSSSSTKYDRGLPSYRSMLWVGPALIFSSATAISMLGWDNKVRSILSTSFPRSVL LGALNDRLLLVNPTDINPRQKKGVEIRSCLIGLLEPLLIGFATMQQYFEQKLDLSEVLYQITSR FTGKQL*(+) MMEDPGHILLSCLKVCQDQQRLSLPSGLSIFLQQDLLELFASEP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |