Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G63690_circ_g.6 |
| ID in PlantcircBase | ath_circ_008532 |
| Alias | At_ciR5485 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 23620334-23620513 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT1G63690 |
| Parent gene annotation |
Signal peptide peptidase-like 2 |
| Parent gene strand | + |
| Alternative splicing | AT1G63690_circ_g.1 AT1G63690_circ_g.2 AT1G63690_circ_g.3 AT1G63690_circ_g.4 AT1G63690_circ_g.5 AT1G63690_circ_g.7 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G63690.2:1 AT1G63690.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.252466359 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23620457-23620510(+) |
| Potential amino acid sequence |
MSYWFVELLVVVFCIGGVEDAIDEIPNTNDGGSGVVEINSISAIFFVVLASGFLVILYKLMSYW FVELLVVVFCIGGVEDAIDEIPNTNDGGSGVVEINSISAIFFVVLASGFLVILYKLMSYWFVEL LVVVFCIGGVEDAIDEIPNTNDGGSGVVEINSISAIFFVVLASGFLVILYKLMSYWFVELLVVV FCIGGVE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |