Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0112300_circ_g.3 |
ID in PlantcircBase | osa_circ_022908 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 720281-720736 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0112300 |
Parent gene annotation |
Eukaryotic initiation factor 3, gamma subunit family protein. (O s04t0112300-01);Eukaryotic initiation factor 3, gamma subunit fa mily protein. (Os04t0112300-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0112300-02:3 Os04t0112300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015148 |
PMCS | 0.355606323 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
720632-720300(+) 720322-720735(-) 720625-720735(-) |
Potential amino acid sequence |
MSSLDKFCAVLLSTRDLLSLVSSCEGPSAASCVVSSSGRGAP*(+) MHPKCFYGAPLPEDDTTQDAADGPSQDETRDNRSLVDNNTAQNLSSDDIEAMKRDGVSGDEIVE ALIANSSTFGKKTLFSQEKYKLKKQKKYAPKVLLRRPSTRR*(-) MKRDGVSGDEIVEALIANSSTFGKKTLFSQEKYKLKKQKKYAPKVLLRRPSTRR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |