Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0112300_circ_g.3 |
| ID in PlantcircBase | osa_circ_022908 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 720281-720736 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0112300 |
| Parent gene annotation |
Eukaryotic initiation factor 3, gamma subunit family protein. (O s04t0112300-01);Eukaryotic initiation factor 3, gamma subunit fa mily protein. (Os04t0112300-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0112300-02:3 Os04t0112300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015148 |
| PMCS | 0.355606323 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
720632-720300(+) 720322-720735(-) 720625-720735(-) |
| Potential amino acid sequence |
MSSLDKFCAVLLSTRDLLSLVSSCEGPSAASCVVSSSGRGAP*(+) MHPKCFYGAPLPEDDTTQDAADGPSQDETRDNRSLVDNNTAQNLSSDDIEAMKRDGVSGDEIVE ALIANSSTFGKKTLFSQEKYKLKKQKKYAPKVLLRRPSTRR*(-) MKRDGVSGDEIVEALIANSSTFGKKTLFSQEKYKLKKQKKYAPKVLLRRPSTRR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |