Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0567100_circ_g.8 |
ID in PlantcircBase | osa_circ_029003 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 28235123-28236077 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0567100 |
Parent gene annotation |
Aspartic proteinase oryzasin 1 precursor (EC 3.4.23.-). (Os05t05 67100-01);Aspartic proteinase oryzasin 1 precursor (EC 3.4.23.-) . (Os05t0567100-02);Similar to Phytepsin. (Os05t0567100-03) |
Parent gene strand | + |
Alternative splicing | Os05g0567100_circ_g.2 Os05g0567100_circ_g.3 Os05g0567100_circ_g.4 Os05g0567100_circ_g.5 Os05g0567100_circ_g.6 Os05g0567100_circ_g.7 Os05g0567100_circ_g.9 Os05g0567100_circ_g.10 Os05g0567100_circ_g.11 Os05g0567100_circ_g.12 Os05g0567100_circ_g.13 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0567100-01:3 Os05t0567100-03:3 Os05t0567100-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.123124782 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28236060-28235132(+) 28235817-28236024(-) |
Potential amino acid sequence |
MGSMVLGFCASGCSAIADSGTSLLAGPTAIITEINEKIGATGVVSQECKTVVSQYGQQILDLLL AETQPSKICSQVGLCTFDGKHGVRILC*(+) MAVGPASNDVPESAIAEQPLAQNPNTMLPIKSTQTNLRADF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |