Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0270200_circ_g.9 |
| ID in PlantcircBase | osa_circ_019090 |
| Alias | Os_ciR9215 |
| Organism | Oryza sativa |
| Position | chr3: 9033241-9033393 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os03g0270200 |
| Parent gene annotation |
Hypothetical conserved gene. (Os03t0270200-01);Splicing factor P WI domain containing protein. (Os03t0270200-02);Conserved hypoth etical protein. (Os03t0270200-03) |
| Parent gene strand | - |
| Alternative splicing | Os03g0270200_circ_g.10 Os03g0270200_circ_g.11 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0270200-02:1 Os03t0270200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.198009804 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9033368-9033390(+) 9033297-9033313(-) |
| Potential amino acid sequence |
MNPNNRRSYRLFVLELCLESSSFSSSASARSGPNLELPASPSYSSFEVKNDMNPNNRRSYRLFV LELCLESSSFSSSASARSGPNLELPASPSYSSFEVKNDMNPNNRRSYRLFVLELCLESSSFSSS ASARSGPNLELPASPSYSSFEVKNDMNPNNRRSY(+) MLRRKKNWILSIAQEQRADSFSDYLGSYRSLPQNCCRTGMPVILD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |