Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0433600_circ_g.2 |
| ID in PlantcircBase | osa_circ_023876 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 21541663-21541753 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder |
| Parent gene | Os04g0433600 |
| Parent gene annotation |
Protein of unknown function DUF668 family protein. (Os04t0433600 -01);Protein of unknown function DUF3475 domain containing prote in. (Os04t0433600-02);Similar to predicted protein. (Os04t043360 0-03) |
| Parent gene strand | - |
| Alternative splicing | Os04g0433600_circ_g.1 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0433600-02:1 Os04t0433600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.293812088 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21541700-21541751(-) |
| Potential amino acid sequence |
MQKLMDLVHRTTARIGKSTTEAAKRNSSCRDAKVDGSCSSYNC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |