Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G34220_circ_g.2 |
| ID in PlantcircBase | ath_circ_005656 |
| Alias | At_ciR5147, Ath_circ_FC0624 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 12464999-12465545 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | AT1G34220 |
| Parent gene annotation |
Regulator of Vps4 activity in the MVB pathway protein |
| Parent gene strand | - |
| Alternative splicing | AT1G34220_circ_g.1 |
| Support reads | 2/3 |
| Tissues | leaf/whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G34220.1:2 AT1G34220.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.150074984 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12465519-12465001(-) |
| Potential amino acid sequence |
MMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAISSVCFAAPRCSDLTELQQVQILFVSKYG KEFVAAASELKPDSGVNRKVEHIIREEKMMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAI SSVCFAAPRCSDLTELQQVQILFVSKYGKEFVAAASELKPDSGVNRKVEHIIREEKMMAAQEIL ELFCELIAVRLPIIEAQRECPLDLKEAISSVCFAAPRCSDLTELQQVQILFVSKYGKEFVAAAS ELKPDSGVNRKVEHIIREEKMMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAISSVCFAAP RCSDLTELQQVQILFVSKYGKEFVAAASELKPDSGVNRK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Chen et al., 2017a |