Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0747800_circ_g.1 |
ID in PlantcircBase | osa_circ_021862 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 30761013-30761980 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0747800 |
Parent gene annotation |
Cysteine synthase (EC 2.5.1.47) (O-acetylserine sulfhydrylase) ( O- acetylserine (Thiol)-lyase) (CSase) (OAS-TL). (Os03t0747800-0 1) |
Parent gene strand | + |
Alternative splicing | Os03g0747800_circ_g.2 Os03g0747800_circ_g.3 Os03g0747800_circ_g.4 |
Support reads | 3 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0747800-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.180968578 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30761027-30761021(+) |
Potential amino acid sequence |
MITDAEEKGLITPGKSVLIEPTSGNTGIGLAFMAAAKGYKLILTMPASMSMERRIILKAFGAEL VLTDPLLGMKGAIQKADELAAKMPNSYILQQFENPANPKIHYETTGPEIWKATAGKVDILVSGI GTGGTVTGTGKYLKEQNPEIKDWL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |