Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G29510_circ_g.3 |
| ID in PlantcircBase | ath_circ_033508 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 14492601-14492921 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT4G29510 |
| Parent gene annotation |
Protein arginine N-methyltransferase 1.1 |
| Parent gene strand | + |
| Alternative splicing | AT4G29510_circ_g.2 AT4G29510_circ_g.4 |
| Support reads | 2 |
| Tissues | root, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G29510.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.528797888 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14492678-14492918(+) |
| Potential amino acid sequence |
MGYFLLFENMLDSVLYARDKWLVEGGVVLPDKASLHLTAIEDSEYKEDKIEFITVLKGKIEEIE LPTPKVDVIISEWMGYFLLFENMLDSVLYARDKWLVEGGVVLPDKASLHLTAIEDSEYKEDKIE FITVLKGKIEEIELPTPKVDVIISEWMGYFLLFENMLDSVLYARDKWLVEGGVVLPDKASLHLT AIEDSEYKEDKIEFITVLKGKIEEIELPTPKVDVIISEWMGYFLLFENMLDSVLYARDKWLVEG GVVLPDKASLHLTAIEDSEYKEDKIE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |