Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0109400_circ_g.2 |
| ID in PlantcircBase | osa_circ_029347 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 552576-553189 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0109400 |
| Parent gene annotation |
ATPase, AAA-type, core domain containing protein. (Os06t0109400- 01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0109400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.408738654 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
552696-552644(+) 552734-553172(-) |
| Potential amino acid sequence |
MERRIVTQLMTCMDEYHQQIGSGSGDVGSESAEKKPGYVIVIGATNRPDAVDQALRRPGRFDRE ISLGVPDEYARKKILMMLTRNLRLEGQLDLLKIARATSSFVGADLKALVDKAGNLAMKRIIDRR RAQFCQEHDENSKHDWWRQPWDANEIEGLSITMDDFEGLLRKTSEACLRRRTGLLHQLYL*(+) MHVINCVTIRRSISRCRFSLLDAIASISSINTIDGAVLYAFLNRLLMFSSEAPQNHPL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |