Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.012G004200_circ_g.1 |
| ID in PlantcircBase | gra_circ_001284 |
| Alias | Chr12:503827|504036 |
| Organism | Gossypium raimondii |
| Position | chrChr12: 503827-504036 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.012G004200 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.012G004200.2:2 Gorai.012G004200.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000371* ghi_circ_000080 |
| PMCS | 0.47386754 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
504007-503828(+) |
| Potential amino acid sequence |
MLRHCGTIRKDKWSSAYDCRTILLSVQSLLGEPNPESPLNTYAAALWNNKEG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |