Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G12920_circ_g.1 |
| ID in PlantcircBase | ath_circ_037837 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 4078205-4078516 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | AT5G12920 |
| Parent gene annotation |
Transducin/WD40 repeat-like superfamily protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G12920.6:2 AT5G12920.7:2 AT5G12920.4:2 AT5G12920.1:2 AT5G12920.3:2 AT5G12920.2:2 AT5G12920.5:2 AT5G12920.8:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.195010683 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4078499-4078207(-) |
| Potential amino acid sequence |
MSEKGIHVLDFHPSSRSPCHVDYDEDTQRNEKRDKCNHRNKFVSLSETVTGCAAHPLNGMIVAG TQIYVVGSMSEKGIHVLDFHPSSRSPCHVDYDEDTQRNEKRDKCNHRNKFVSLSETVTGCAAHP LNGMIVAGTQIYVVGSMSEKGIHVLDFHPSSRSPCHVDYDEDTQRNEKRDKCNHRNKFVSLSET VTGCAAHPLNGMIVAGTQIYVVGSMSEKGIHVLDFHPSSRSPCHVDYDEDTQRNEKRDKCNHRN KFVSLSETVTGCAAHPLNGMIVAGTQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |