logo





circRNA ID
AT1G01650_circ_g.1
Alias
ath_circ_000090
Organism
Arabidpsis thaliana
Position
chr1: 233387-233470  JBrowse»
Reference genome
TAIR10.38
Type  
e-circRNA
Identification method
KNIFE, PcircRNA_finder, CIRI-full
Parent gene
Parent gene annotation
Signal peptide peptidase-like 4
Parent gene strand
-
Alternative splicing
NA
Splice junction sequence  
GTCCGTCCATCAAGTTTAGAGCTATGTATGTTATGAGAAGACctagtatgaatgggacgatgta
aagcagagccggttgcccat
Support reads
1
Tissues
leaf
Exon boundary  
Yes-Yes
Splicing signals  
CT-AC
Sanger sequencing for BSS  
NA
PCR primers for BSS  
NA
Assembled circRNA sequence  
CTAGTATGAATGGGACGATGTAAAGCAGAGCCGGTTGCCCATGTCCGTCCATCAAGTTTAGAGC
TATGTATGTTATGAGAAGAC
Sanger sequencing for FL  
NA
PCR primers for FL  
NA
Genomic sequence
CTAGTATGAATGGGACGATGTAAAGCAGAGCCGGTTGCCCATGTCCGTCCATCAAGTTTAGAGC
TATGTATGTTATGAGAAGAC
Number of exons covered
AT1G01650.2:1
AT1G01650.4:1
AT1G01650.1:1
AT1G01650.3:1
Conserved circRNAs
NA
Coding potential
Y
Potential coding position
233439-233389(-)
Potential amino acid sequence
MDGHGQPALLYIVPFILGLLITYIALNLMDGHGQPALLYIVPFILGLLITYIALNLMDGHGQPA
LLYIVPFILGLLITYIALNLMDGHGQPALLYIVPFIL(-)
Sponge-miRNAs
NA
circRNA-miRNA-mRNA network
References
Chu et al., 2017

Copyright©2017-2021 Institute of Crop Sciences / Institute of Bioinformatics, Zhejiang University.
Any questions or suggestions, please contact the Fan's lab, bioinplant@zju.edu.cn
For submittion, please click here. Last modified at 2021-03-09.

Supported by   nsfc    zju