Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0191300_circ_g.1 |
ID in PlantcircBase | osa_circ_013587 |
Alias | Os_ciR8303 |
Organism | Oryza sativa |
Position | chr2: 5060852-5061286 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0191300 |
Parent gene annotation |
Similar to Amino acid transporter-like protein. (Os02t0191300-01 ) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0191300-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.516516858 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5060999-5060865(+) 5061274-5061284(-) |
Potential amino acid sequence |
MSMDASVSNATRMIIRIPGIIPSILMLAGSAIIPAPTMVVDRLNTAPEKEAPLNSWIPSSSSLI GRSGVVSSRISLCDTCLLSLGDPFPIPICVRYPTIIM*(+) MGIGNGSPSDSRHVSHKEIRDETTPLLPIKEEEEGIHEFNGASFSGAVFNLSTTIVGAGIMALP ASIKMLGIIPGILMIILVALLTEASIDMLVRCSHEGKITSYGWLMGETFGQWGRIALQASVVIN NIGMMIVYMIIVG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |