Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G34460_circ_g.1 |
| ID in PlantcircBase | ath_circ_016433 |
| Alias | At_ciR963, Ath_circ_FC4774, AT2G34460_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 14529841-14530023 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ, circseq_cup, CIRI-full, CIRI2 |
| Parent gene | AT2G34460 |
| Parent gene annotation |
Uncharacterized protein At2g34460, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 6/1 |
| Tissues | leaf/aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G34460.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.528081359 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14529841-14530020(+) |
| Potential amino acid sequence |
MEKGEAENAVKTKKVFVAGATGQTGKRIVEQLLSRGFAVKAGVRDVEKAKTSFKDDPSLQIMEK GEAENAVKTKKVFVAGATGQTGKRIVEQLLSRGFAVKAGVRDVEKAKTSFKDDPSLQIMEKGEA ENAVKTKKVFVAGATGQTGKRIVEQLLSRGFAVKAGVRDVEKAKTSFKDDPSLQIMEKGEAENA VKTKKVFVAGATGQTGKRIVEQLLSRGFAVKAGVRDVEKAKTSFKDDPSLQI(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |