Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G34460_circ_g.1 |
ID in PlantcircBase | ath_circ_016433 |
Alias | At_ciR963, Ath_circ_FC4774, AT2G34460_C1 |
Organism | Arabidpsis thaliana |
Position | chr2: 14529841-14530023 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ, circseq_cup, CIRI-full, CIRI2 |
Parent gene | AT2G34460 |
Parent gene annotation |
Uncharacterized protein At2g34460, chloroplastic |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 6/1 |
Tissues | leaf/aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G34460.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.528081359 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14529841-14530020(+) |
Potential amino acid sequence |
MEKGEAENAVKTKKVFVAGATGQTGKRIVEQLLSRGFAVKAGVRDVEKAKTSFKDDPSLQIMEK GEAENAVKTKKVFVAGATGQTGKRIVEQLLSRGFAVKAGVRDVEKAKTSFKDDPSLQIMEKGEA ENAVKTKKVFVAGATGQTGKRIVEQLLSRGFAVKAGVRDVEKAKTSFKDDPSLQIMEKGEAENA VKTKKVFVAGATGQTGKRIVEQLLSRGFAVKAGVRDVEKAKTSFKDDPSLQI(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |