Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc12g056940.1_circ_g.1 |
| ID in PlantcircBase | sly_circ_003657 |
| Alias | 12:48370483|48370674 |
| Organism | Solanum lycopersicum |
| Position | chr12: 63012735-63012926 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc12g056940.1 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 10 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc12g056940.1.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.766464974 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
63012868-63012737(-) |
| Potential amino acid sequence |
MSDGSHVDADTPYAEVEVMKMCMPLLSPASGVIHFKMSEGQAMQNDHDPSKLVAETPCKLLRYL MSDGSHVDADTPYAEVEVMKMCMPLLSPASGVIHFKMSEGQAMQNDHDPSKLVAETPCKLLRYL MSDGSHVDADTPYAEVEVMKMCMPLLSPASGVIHFKMSEGQAMQNDHDPSKLVAETPCKLLRYL MSDGSHVDADTPYAEVEVMKMCMPLLSPASGVIHFKMSEGQAMQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |