Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA010399_circ_g.1 |
ID in PlantcircBase | osi_circ_004917 |
Alias | 3:23389393|23389849 |
Organism | Oryza sativa ssp. indica |
Position | chr3: 23389393-23389849 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA010399 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA010399-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23389494-23389847(-) 23389740-23389611(+) 23389801-23389411(+) |
Potential amino acid sequence |
MASVRGLRQRRLLLHRRYPPRLPPRLLLRPRRCA*(-) MTSEITTDRMNDSTVTTTTENAADLGFPAPSSLLTLTRSAEVEVEAEEAAEGDTDDVVAAYVDV GHERLPSAAHGHT*(+) MPPTWGSQHRAHCSPSRAAPRSK*(+) |
Sponge-miRNAs | osa-miR5487 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |