Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d029938_circ_g.1 |
ID in PlantcircBase | zma_circ_000682 |
Alias | circ176 |
Organism | Zea mays |
Position | chr1: 95646408-95646749 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI |
Parent gene | Zm00001d029938 |
Parent gene annotation |
Protein ARABIDILLO 1 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3 |
Tissues | seedling leaves |
Exon boundary | Yes-Yes |
Splicing signals | GT-CA |
Number of exons covered | Zm00001d029938_T001:2 Zm00001d029938_T009:2 Zm00001d029938_T003:2 Zm00001d029938_T006:2 Zm00001d029938_T007:2 Zm00001d029938_T005:2 Zm00001d029938_T004:2 Zm00001d029938_T002:2 Zm00001d029938_T010:2 Zm00001d029938_T008:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.043372295 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
95646701-95646425(+) |
Potential amino acid sequence |
MTETVKPLLQWVALKLWAARGLANLAAHGDNNDNNAAVGQEAGALEALVQLTSSQNEGVRQEAA GALWNLSFDDRNREAIAAVGGVEALGCKRSG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chen et al., 2017b |